fuskator.com

🖥 Status: up
🕒 Response Time: 0.001 sec
⬅️ Response Code: not set
fuskator.com

Over the last 2 101 days beginning November 11, 2020, to now, fuskator.com's accessibility was checked 155 times. Responding with a code 200, fuskator.com was operational 124 times, most recently on August 10, 2026, out of every check attempted. Out of all evaluations, fuskator.com was unreachable 2.58% of the time, equaling 4 events, with the latest occurrence on December 5, 2020. Among the 27 error-containing responses, the most current error, coded as 521, was detected on April 13, 2026. The August 10, 2026, response time of 0.001 seconds for fuskator.com differed from its average of 0.557 seconds.

4.0
155
Last Updated: August 10, 2026

Fuskator overview

Domain
fuskator.com
Title
Fuskator - Just Porn Galleries, That's All
Description
Fuskator provides nude image galleries contributed by users similar to image dump sites.
R Site Status Rank
1 788
Search Wikipedia
fuskator.com
Alternatives
alternatives to fuskator.com
Recently checked
r2games.com

heroesreplay.net

Last Updated: August 3, 2026
Status: down
Response Time: — sec
Response Code:

radiovaticana.va

Last Updated: May 6, 2026
Status: up
Response Time: 1.558 sec
Response Code: 200

technologycraze.co.uk

Last Updated: June 28, 2026
Status: down
Response Time: — sec
Response Code:

mrmemory.co.uk

Last Updated: June 4, 2026
Status: error
Response Time: 0.058 sec
Response Code: 403

atkarchives.com

Last Updated: August 9, 2026
Status: error
Response Time: 0.914 sec
Response Code: 502

readinggate.com

Last Updated: May 5, 2026
Status: up
Response Time: 3.416 sec
Response Code: 200

publicrecords360.com

Last Updated: July 26, 2026
Status: error
Response Time: 0.063 sec
Response Code: 403

Fuskator.com
status check request map as of August 13, 2026

fuskator.com request, August 10, 2026

Country report for fuskator.com as of August 13, 2026

Other Countries 100.00%
14:07
SiteTotal ChecksLast Modified
verycd.comverycd.com44January 28, 2021
r2games.comr2games.com43January 28, 2021
fuskator.comfuskator.com155November 11, 2020
questionablecontent.netquestionablecontent.net51January 28, 2021
thumbtack.comthumbtack.com33January 28, 2021

Radiovaticana.va

Fuskator.com

General SEO Report

Page TitlePage Title tips for fuskator.com: Utilize title case formatting within website titles to enhance readability and appear prominently in search results, improving click-through rates by making keywords stand out visually to both human users and search engine algorithms.
Fuskator - Just Porn Galleries, That's All

Length: 47 characters
Meta DescriptionMeta Description tips for fuskator.com: Meta tags are crucial for click-through rates, so ensure your description accurately reflects the page content and incorporates relevant long-tail keywords naturally within the first 150 characters.
Fuskator provides nude image galleries contributed by users similar to image dump sites.

Length: 88 characters
Meta KeywordsMeta Keywords tips for fuskator.com: Meta keywords hold significantly less weight in contemporary search engine algorithms like Google's, which now rely more heavily on analyzing actual page content structure, user engagement metrics, and semantic relevance rather than keyword lists explicitly provided by webmasters.
no meta keywords data for fuskator.com
2026-08-13T23:44:48+00:00
Page ContentPage Content tips for fuskator.com: Structure your page content using schema markup and appropriate HTML headings (H1, H2, H3, etc.) to help search engines understand content hierarchy and context more effectively.
Web Page Content Length: 30355 characters
H1 HeadingH1 Heading tips for fuskator.com: A well-structured H1 heading is instrumental in preventing keyword cannibalization issues by clearly defining the primary topic for each page, avoiding potential internal competition and confusion for search algorithms.
no h1 heading data for fuskator.com
2026-08-13T23:44:48+00:00
H2 HeadingsH2 Headings tips for fuskator.com: While H1 tags represent the main topic, H2 headers allow you to delve into supporting details, examples, or distinct aspects of that topic, enriching the user's understanding and fulfilling informational gaps.
no h2 headings data for fuskator.com
2026-08-13T23:44:48+00:00
H3 HeadingsH3 Headings tips for fuskator.com: Integrate your primary and secondary keywords naturally into the copy of your h3 headers, balancing keyword usage with readability and ensuring your content remains valuable and user-friendly for organic searches.
no h3 headings data for fuskator.com
2026-08-13T23:44:48+00:00
H4 HeadingsH4 Headings tips for fuskator.com: H4 tags should be used strategically to break down detailed content under H3 headers, improving content structure, readability, and user engagement on web pages.
no h4 headings data for fuskator.com
2026-08-13T23:44:48+00:00
H5-H6 HeadingsH5-H6 Headings tips for fuskator.com: The semantic importance of H5 and H6 diminishes significantly compared to H1-H2, meaning their placement should be driven primarily by genuine structural needs rather than arbitrary SEO tactics.
no h5-h6 headings data for fuskator.com
2026-08-13T23:44:48+00:00
Image ALT AttributesImage ALT Attributes tips for fuskator.com: Optimize your website's images by assigning descriptive ALT tags that clearly explain what each image shows, does, or represents in relation to the page content.
no image alt attributes data for fuskator.com
2026-08-13T23:44:48+00:00
Robots.txtRobots.txt tips for fuskator.com: Avoid using the robots.txt file to restrict access to entire sections of your public-facing website that you intend to rank for, as this would prevent search engines like Google and Bing from crawling and indexing those valuable pages, thereby missing out on potential organic traffic and revenue opportunities.
file robots.txt was found on the website
XML SitemapXML Sitemap tips for fuskator.com: Regularly update and submit your XML sitemap whenever you add significant new content to your website, ensuring that search engine indexes remain current, relevant, and comprehensive, reflecting the full scope and scope of your online presence accurately.
https://fuskator.com/sitemap_gallery.xml
https://fuskator.com/sitemap_gallery2.xml
https://fuskator.com/sitemap_gallery3.xml
https://fuskator.com/sitemap_gallery4.xml
https://fuskator.com/sitemap_gallery5.xml
https://fuskator.com/sitemap_gallery6.xml
https://fuskator.com/sitemap_gallery7.xml
https://fuskator.com/sitemap_gallery8.xml


available for crawling
Page SizePage Size tips for fuskator.com: Regularly audit your website's performance using tools like Google PageSpeed Insights to receive actionable recommendations for further shrinking page size and enhancing site speed.
page size: 30 kb
Response TimeResponse Time tips for fuskator.com: Compress assets thoroughly, minify CSS and JavaScript code, and defer non-critical render-blocking resources to accelerate initial page load response times, enhancing mobile usability.
response time: 0.557 sec
Minify CSSMinify CSS tips for fuskator.com: Modern build tools offer seamless CSS minification or obfuscation capabilities during the deployment pipeline automatically, saving developers valuable time and ensuring site performance remains top-notch without manual intervention needed.
Minified:
/css/vendor.min.css?1.3.43
/css/fuskator.min.css?1.3.43


included in the page
Minify JavaScriptMinify JavaScript tips for fuskator.com: Professionally minified JavaScript files execute faster because the browser doesn't have to spend valuable processing time parsing through redundant characters and unnecessary whitespace, resulting in immediate interactivity improvements and higher perceived performance for website visitors.
Minified:
/scripts/vendor.min.js?1.3.43
/scripts/global.min.js?1.3.43
/scripts/app.min.js?1.3.43
/ea.js


detected during site scan
Structured DataStructured Data tips for fuskator.com: Consider implementing diverse Schema types beyond local business information, such as product or review schemas, to capture additional ranking opportunities, user engagement, and rich snippet potential for different content sections.
no structured data data for fuskator.com
2026-08-13T23:44:48+00:00
CDN UsageCDN Usage tips for fuskator.com: Integrate Cloudflare's CDN with your website by updating the DNS settings to point CNAME records for assets or use their automatic DNS configuration; once integrated, Cloudflare's extensive global network automatically caches and serves content from edge locations, drastically improving load times for users globally, especially those closer geographically to the edge server nearest their location.
no cdn usage data for fuskator.com
2026-08-13T23:44:48+00:00
SSL certificatesSSL certificates tips for fuskator.com: Responsive design combined with SSL is now critical for mobile usability and security, traits search engines increasingly factor into ranking algorithms as key determinants of website quality and relevance.
SSL is enabled on the website

Estimated Traffic

Minimum Daily Unique Visitors:149 167
Minimum Daily Visits:174 327
Minimum Daily Page Views:300 131
Minimum Monthly Unique Visitors:4 475 010
Minimum Monthly Visits:5 229 810
Minimum Monthly Page Views:9 003 930
Minimum Yearly Unique Visitors:53 700 120
Minimum Yearly Visits:62 757 720
Minimum Yearly Page Views:108 047 160
Maximum Daily Unique Visitors:188 705
Maximum Daily Visits:201 285
Maximum Daily Page Views:339 669
Maximum Monthly Unique Visitors:5 661 150
Maximum Monthly Visits:6 038 550
Maximum Monthly Page Views:10 190 070
Maximum Yearly Unique Visitors:67 933 800
Maximum Yearly Visits:72 462 600
Maximum Yearly Page Views:122 280 840

Estimated Valuation

Daily Revenue:US$ 216 - 485
Monthly Revenue:US$ 6 480 - 14 550
Yearly Revenue:US$ 77 760 - 174 600

Estimated Worth

Minimum:US$ 116 640
Maximum:US$ 523 800

Similarly Ranked Sites

RankPoints
plaync.complaync.com5 4004 639 670
nchsoftware.comnchsoftware.com5 4014 639 669
desjardins.comdesjardins.com5 4024 639 669
verycd.comverycd.com5 4034 639 669
r2games.comr2games.com5 4044 639 668
fuskator.comfuskator.com5 4054 639 668
questionablecontent.netquestionablecontent.net5 4064 639 668
thumbtack.comthumbtack.com5 4074 639 667
watchmygirlfriend.tvwatchmygirlfriend.tv5 4084 639 667
lever.colever.co5 4094 639 667
game-game.com.uagame-game.com.ua5 4104 639 666